Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1) antibody

Antigen

N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1)

Synonyms MGC82286, asah1, MGC173782, zgc:101637, ASAH1, MGC140781, DKFZp469G2224, AC, PHP, ASAH, PHP32, FLJ21558, FLJ22079, Asah, AL022942, AU044555, 2310081N20Rik
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634057
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name ASAH1
Immunogen ASAH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTP
Description This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally.
Molecular Weight 14 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASAH1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Metabolism

Alternatives

Alternatives for antigen "N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1)", type "Antibodies"
Hosts Mouse (6), Rabbit (4)
Reactivities Human (9)
Applications Western Blotting (WB) (10), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), ELISA (4), Enzyme Immunoassay (EIA) (3), ELISA (Detection) (1)