ART4 antibody
-
- Target See all ART4 Antibodies
- ART4 (ADP-Ribosyltransferase 4 (Dombrock Blood Group) (ART4))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ART4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ART4 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTLFTIF
- Top Product
- Discover our top product ART4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ART4 Blocking Peptide, catalog no. 33R-9161, is also available for use as a blocking control in assays to test for specificity of this ART4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ART4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ART4 (ADP-Ribosyltransferase 4 (Dombrock Blood Group) (ART4))
- Alternative Name
- ART4 (ART4 Products)
- Synonyms
- ARTC4 antibody, CD297 antibody, DO antibody, DOK1 antibody, ATR4 antibody, 4432404K01Rik antibody, Dombrock antibody, ADP-ribosyltransferase 4 (Dombrock blood group) antibody, ADP-ribosyltransferase 4 antibody, ART4 antibody, Art4 antibody
- Background
- ART4 is a protein that contains a mono-ADP-ribosylation (ART) motif. It is a member of the ADP-ribosyltransferase gene family but enzymatic activity has not been demonstrated experimentally. Antigens of the Dombrock blood group system are located on the gene product, which is glycosylphosphatidylinosotol-anchored to the erythrocyte membrane. Allelic variants, some of which lead to adverse transfusion reactions, are known.
- Molecular Weight
- 31 kDa (MW of target protein)
-