NEK3 antibody

Catalog No. ABIN634077

Product Details anti-NEK3 Antibody

Target: NEK3 (NIMA related kinase 3 (NEK3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NEK3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NEK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NEK3 Blocking Peptide, catalog no. 33R-3099, is also available for use as a blocking control in assays to test for specificity of this NEK3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NEK3

Target: NEK3 (NIMA related kinase 3 (NEK3))

Alternative Name: NEK3 (NEK3 Products)

Synonyms: HSPK36 antibody, ATNEK3 antibody, NIMA-RELATED KINASE3 antibody, NIMA-related kinase 3 antibody, T8M17.60 antibody, T8M17_60 antibody, NIMA related kinase 3 antibody, NIMA (never in mitosis gene a)-related expressed kinase 3 antibody, NIMA-related kinase 3 S homeolog antibody, NIMA-related kinase 3 antibody, NEK3 antibody, Nek3 antibody, nek3.S antibody

Background: NEK3 is a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. It differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase is activated by prolactin stimulation, leading to phosphorylation of VAV2 guanine nucleotide exchange factor, paxillin, and activation of the RAC1 GTPase.

Molecular Weight: 58 kDa (MW of target protein)