MAPK4 antibody (Middle Region)

Catalog No. ABIN634082

The Rabbit Polyclonal anti-MAPK4 antibody is suitable to detect MAPK4 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for MAPK4 antibody (Middle Region) (ABIN634082)

Target: MAPK4 (Mitogen-Activated Protein Kinase 4 (MAPK4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAPK4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAPK4 Antibody

Binding Specificity: Middle Region

Specificity: MAPK4 antibody was raised against the middle region of MAPK4

Purification: Affinity purified

Immunogen: MAPK4 antibody was raised using the middle region of MAPK4 corresponding to a region with amino acids DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAPK4 Blocking Peptide, (ABIN937316), is also available for use as a blocking control in assays to test for specificity of this MAPK4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAPK4

Target: MAPK4 (Mitogen-Activated Protein Kinase 4 (MAPK4))

Alternative Name: MAPK4

Background: Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus where it phosphorylates nuclear targets.

Molecular Weight: 66 kDa (MW of target protein)

Pathways: MAPK Signaling