CHAF1B antibody

Catalog No. ABIN634083

Product Details anti-CHAF1B Antibody

Target: CHAF1B (Chromatin Assembly Factor 1, Subunit B (p60) (CHAF1B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHAF1B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CHAF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHAF1B Blocking Peptide, catalog no. 33R-4709, is also available for use as a blocking control in assays to test for specificity of this CHAF1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHAF1B

Target: CHAF1B (Chromatin Assembly Factor 1, Subunit B (p60) (CHAF1B))

Alternative Name: CHAF1B (CHAF1B Products)

Synonyms: CHAF1B antibody, wu:fd07c09 antibody, wu:fe36g06 antibody, wu:fv38g09 antibody, zgc:56096 antibody, CAF-1 antibody, CAF-IP60 antibody, CAF1 antibody, CAF1A antibody, CAF1P60 antibody, MPHOSPH7 antibody, MPP7 antibody, 2600017H24Rik antibody, C76145 antibody, CAF-I p60 antibody, CAF-Ip60 antibody, caf-1 antibody, CAF-1P60 antibody, chromatin assembly factor 1 subunit B antibody, chromatin assembly factor 1, subunit B antibody, chromatin assembly factor 1, subunit B (p60) antibody, chromatin assembly factor 1 subunit B L homeolog antibody, CHAF1B antibody, chaf1b antibody, Chaf1b antibody, chaf1b.L antibody

Background: Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. CHAF1B corresponds to the p60 subunit and is required for chromatin assembly after replication. CHAF1B is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair.

Molecular Weight: 61 kDa (MW of target protein)