Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC1) antibody

Antigen

X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC1)

Synonyms DKFZp781P0919, RecA, RAD51, 4921524O04Rik, 8030409M04Rik, XRCC2, RGD1564823, MGC160004
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634115
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name XRCC2
Immunogen XRCC2 antibody was raised using the middle region of XRCC2 corresponding to a region with amino acids CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA
Description XRCC2 is a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.
Molecular Weight 31 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XRCC2 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Chromatin and Nuclear Signaling, DNA/RNA

Alternatives

Alternatives for antigen "X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC1)", type "Antibodies"
Hosts Rabbit (15), Mouse (2)
Reactivities Human (16)
Applications Western Blotting (WB) (14), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (10), ELISA (Detection) (2), Enzyme Immunoassay (EIA) (2), Immunohistochemistry (Frozen Sections) (IHC (fro)) (2), Immunohistochemistry (IHC) (2), ELISA (1), Flow Cytometry (FACS) (1), Immunocytochemistry (ICC) (1)