»
Antibodies
»
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC1...
X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC1) antibody
| Antigen |
|
| Synonyms |
DKFZp781P0919, RecA, RAD51, 4921524O04Rik, 8030409M04Rik, XRCC2, RGD1564823, MGC160004 |
| Clonality |
Polyclonal |
|
Host
|
|
|
Application
|
|
| Catalog no. |
ABIN634115 |
| Quantity |
50 ug (1 mg/ml) (Variants) |
| Price |
478.33 $ Plus shipping costs $35.00
|
| Shipping to |
|
| Availability |
Ships within 5 to 7 Business Days |
|
Alternative name
|
XRCC2
|
|
Immunogen
|
XRCC2 antibody was raised using the middle region of XRCC2 corresponding to a region with amino acids CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA
|
|
Description
|
XRCC2 is a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.
|
|
Molecular Weight
|
31 kDa (MW of target protein)
|
|
Concentration
|
1 mg/ml
|
|
Purification
|
Affinity purified
|
|
Buffer
|
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XRCC2 antibody in PBS
|
|
Storage
|
Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
|
|
Research Area
|
Chromatin and Nuclear Signaling, DNA/RNA
|
Alternatives for antigen "X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC1)", type "Antibodies"