XRCC2 antibody (Middle Region)

Catalog No. ABIN634115

The Rabbit Polyclonal anti-XRCC2 antibody is suitable to detect XRCC2 in samples from Human. It has been validated for WB.

Quick Overview for XRCC2 antibody (Middle Region) (ABIN634115)

Target: XRCC2 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XRCC2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-XRCC2 Antibody

Binding Specificity: Middle Region

Specificity: XRCC2 antibody was raised against the middle region of XRCC2

Purification: Affinity purified

Immunogen: XRCC2 antibody was raised using the middle region of XRCC2 corresponding to a region with amino acids CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XRCC2 Blocking Peptide, (ABIN937126), is also available for use as a blocking control in assays to test for specificity of this XRCC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRCC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for XRCC2

Target: XRCC2 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2))

Alternative Name: XRCC2

Background: XRCC2 is a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.

Molecular Weight: 31 kDa (MW of target protein)

Pathways: DNA Damage Repair