KIF9 antibody (N-Term)
-
- Target See all KIF9 Antibodies
- KIF9 (Kinesin Family Member 9 (KIF9))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIF9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KIF9 antibody was raised against the n terminal of KIF9
- Purification
- Affinity purified
- Immunogen
- KIF9 antibody was raised using the N terminal of KIF9 corresponding to a region with amino acids MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQ
- Top Product
- Discover our top product KIF9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIF9 Blocking Peptide, catalog no. 33R-6084, is also available for use as a blocking control in assays to test for specificity of this KIF9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF9 (Kinesin Family Member 9 (KIF9))
- Alternative Name
- KIF9 (KIF9 Products)
- Synonyms
- RGD1565187 antibody, si:dkey-86l18.8 antibody, kinesin family member 9 antibody, si:dkey-86l18.8 antibody, KIF9 antibody, Kif9 antibody
- Background
- KIF9 acts as a regulator of podosomes and of podosomal matrix degradation in primary human macrophages.
- Molecular Weight
- 75 kDa (MW of target protein)
-