GINS2 antibody
-
- Target See all GINS2 Antibodies
- GINS2 (GINS Complex Subunit 2 (Psf2 Homolog) (GINS2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GINS2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GINS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAIN
- Top Product
- Discover our top product GINS2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GINS2 Blocking Peptide, catalog no. 33R-1841, is also available for use as a blocking control in assays to test for specificity of this GINS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GINS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GINS2 (GINS Complex Subunit 2 (Psf2 Homolog) (GINS2))
- Alternative Name
- GINS2 (GINS2 Products)
- Synonyms
- pfs2 antibody, psf2 antibody, hspc037 antibody, si:dkey-265o13.3 antibody, zgc:112262 antibody, HSPC037 antibody, PSF2 antibody, Pfs2 antibody, 2210013I18Rik antibody, 4833427B12Rik antibody, AI323585 antibody, RGD1311055 antibody, probable DNA replication complex GINS protein PSF2 antibody, GINS complex subunit 2 (Psf2 homolog) antibody, DNA replication complex GINS protein PSF2 antibody, GINS complex subunit 2 antibody, GINS complex subunit 2 (Psf2 homolog) L homeolog antibody, similar to C terminus of S. cerevisiae PSF2 (YJL072C) component of the GINS complex involved in DNA replication initiation; rest of gene upstream of small intron antibody, LOC408755 antibody, gins2 antibody, psf2 antibody, GINS2 antibody, Gins2 antibody, gins2.L antibody, PSF2 antibody
- Background
- The yeast heterotetrameric GINS complex is made up of Sld5, Psf1, Psf2, and Psf3. The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts.
- Molecular Weight
- 21 kDa (MW of target protein)
- Pathways
- DNA Replication, Synthesis of DNA
-