Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

K-Ras antibody

Antigen

K-Ras
Clonality Polyclonal
Host
Alternatives

Rabbit
Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634246
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information
Application Details Alternatives Secondary Antibodies back to top

Alternative name KRAS
Immunogen KRAS antibody was raised using the N terminal of KRAS corresponding to a region with amino acids TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC
Description KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.
Molecular Weight 22 kDa (MW of target protein)

Application Details
Alternatives Secondary Antibodies back to top

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KRAS antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternatives
Application Details Secondary Antibodies back to top

Alternatives for antigen "K-Ras", type "Antibodies"
Hosts Rabbit (25), Mouse (7)
Reactivities Human (32), Mouse (Murine) (19), Rat (Rattus) (19), Dog (Canine) (2), Horse (Equine) (2), Rabbit (2), Sheep (Ovine) (2), Cow (Bovine) (1), Pig (Porcine) (1)
Applications Immunofluorescence (IF) (20), Flow Cytometry (FACS) (18), Western Blotting (WB) (12), ELISA (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Enzyme Immunoassay (EIA) (5), Immunoprecipitation (IP) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)