PARK7/DJ1 antibody

Catalog No. ABIN634300

Product Details anti-PARK7/DJ1 Antibody

Target: PARK7/DJ1 (PARK7) (Parkinson Protein 7 (PARK7))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARK7/DJ1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PARK7 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARK7 Blocking Peptide, catalog no. 33R-9402, is also available for use as a blocking control in assays to test for specificity of this PARK7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARK7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARK7/DJ1

Target: PARK7/DJ1 (PARK7) (Parkinson Protein 7 (PARK7))

Alternative Name: PARK7 (PARK7 Products)

Synonyms: DJ-1 antibody, DJ1 antibody, CAP1 antibody, Dj1 antibody, SP22 antibody, dj1 antibody, zgc:103725 antibody, park7b antibody, park7 antibody, park7a antibody, Parkinsonism associated deglycase antibody, Parkinson disease (autosomal recessive, early onset) 7 antibody, parkinson protein 7 antibody, parkinson protein 7 S homeolog antibody, parkinson protein 7 L homeolog antibody, PARK7 antibody, Park7 antibody, park7 antibody, park7.S antibody, park7.L antibody

Background: PARK7 belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7.

Molecular Weight: 20 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Proton Transport