GUCY1B3 antibody (N-Term)

Catalog No. ABIN634375

Product Details anti-GUCY1B3 Antibody

Target: GUCY1B3 (Guanylate Cyclase 1, Soluble, beta 3 (GUCY1B3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GUCY1B3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GUCY1 B3 antibody was raised against the N terminal of GUCY1 3

Purification: Affinity purified

Immunogen: GUCY1 B3 antibody was raised using the N terminal of GUCY1 3 corresponding to a region with amino acids LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GUCY1B3 Blocking Peptide, catalog no. 33R-5041, is also available for use as a blocking control in assays to test for specificity of this GUCY1B3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUCY0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GUCY1B3

Target: GUCY1B3 (Guanylate Cyclase 1, Soluble, beta 3 (GUCY1B3))

Alternative Name: GUCY1B3 (GUCY1B3 Products)

Synonyms: GUCY1B3 antibody, AMGC1 antibody, AmsGC-beta1 antibody, AmsGCbeta1 antibody, GB20021 antibody, Gucy1b3 antibody, gucy1b3 antibody, GC-S-beta-1 antibody, GC-SB3 antibody, GUC1B3 antibody, GUCB3 antibody, GUCSB3 antibody, GUCY1B1 antibody, SGCB1 antibody, GCbeta1 antibody, Gucy1b1 antibody, SGC antibody, guanylate cyclase 1 soluble subunit beta antibody, guanylate cyclase 1, soluble, beta 3 antibody, guanylate cyclase, soluble, beta 1 antibody, guanylate cyclase 1, soluble, beta 3 S homeolog antibody, guanylate cyclase 1 soluble subunit beta 3 antibody, GUCY1B3 antibody, gucy1b3 antibody, Gycbeta1 antibody, gucy1b3.S antibody, Gucy1b3 antibody

Background: Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha subunit and a beta subunit, typically GUCY1B3, catalyzes conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide (NO) and nitrovasodilator drugs.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis