OTUD6B antibody (Middle Region)
-
- Target See all OTUD6B Antibodies
- OTUD6B (OTU Domain Containing 6B (OTUD6B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OTUD6B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- OTUD6 B antibody was raised against the middle region of OTUD6
- Purification
- Affinity purified
- Immunogen
- OTUD6 B antibody was raised using the middle region of OTUD6 corresponding to a region with amino acids EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC
- Top Product
- Discover our top product OTUD6B Primary Antibody
-
anti-OTU Domain Containing 6B (OTUD6B) (AA 1-293) antibody
OTUD6B Reactivity: Human WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-OTU Domain Containing 6B (OTUD6B) (AA 234-262), (C-Term) antibodyOTUD6B Reactivity: Human WB, FACS Host: Rabbit Polyclonal RB27397 unconjugated
anti-OTU Domain Containing 6B (OTUD6B) (AA 31-323) antibodyOTUD6B Reactivity: Human WB, IHC, IP Host: Rabbit Polyclonal unconjugated
anti-OTU Domain Containing 6B (OTUD6B) (AA 1-293) antibodyOTUD6B Reactivity: Human WB, ELISA Host: Mouse Monoclonal 3H4 unconjugated
anti-OTU Domain Containing 6B (OTUD6B) (C-Term) antibodyOTUD6B Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish (Danio rerio), Bat, Chicken, Pig, Xenopus laevis WB Host: Rabbit Polyclonal unconjugated
anti-OTU Domain Containing 6B (OTUD6B) antibodyOTUD6B Reactivity: Human, Mouse WB, FACS Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OTUD6B Blocking Peptide, catalog no. 33R-2473, is also available for use as a blocking control in assays to test for specificity of this OTUD6B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTUD0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OTUD6B (OTU Domain Containing 6B (OTUD6B))
- Alternative Name
- OTUD6B (OTUD6B Products)
- Synonyms
- DUBA5 antibody, 2600013N14Rik antibody, AU015433 antibody, RGD1310024 antibody, zgc:56305 antibody, duba5 antibody, DKFZp459J184 antibody, OTU domain containing 6B antibody, OTU domain containing 6B S homeolog antibody, OTU domain containing 6B L homeolog antibody, OTUD6B antibody, Otud6b antibody, otud6b antibody, otud6b.S antibody, otud6b.L antibody
- Background
- Deubiquitinating enzymes are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.
- Molecular Weight
- 37 kDa (MW of target protein)
-
