MYD88 antibody

Catalog No. ABIN634398

The Rabbit Polyclonal anti-MYD88 antibody (ABIN634398) specifically detects MYD88 in WB. The antibody is reactive with Human samples.

Quick Overview for MYD88 antibody (ABIN634398)

Target: MYD88 (Myeloid Differentiation Primary Response Gene (88) (MYD88))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MYD88 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MYD88 Antibody

Purification: Affinity purified

Immunogen: MYD88 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MYD88 Blocking Peptide, (ABIN936133), is also available for use as a blocking control in assays to test for specificity of this MYD88 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYD88 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MYD88

Target: MYD88 (Myeloid Differentiation Primary Response Gene (88) (MYD88))

Alternative Name: MYD88

Background: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, TLR Signaling, Neurotrophin Signaling Pathway, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades