RAB40A antibody (Middle Region)

Catalog No. ABIN634428

The Rabbit Polyclonal anti-RAB40A antibody (ABIN634428) specifically detects RAB40A in WB. The antibody is reactive with Human samples.

Quick Overview for RAB40A antibody (Middle Region) (ABIN634428)

Target: RAB40A (RAB40A, Member RAS Oncogene Family (RAB40A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB40A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAB40A Antibody

Binding Specificity: Middle Region

Specificity: RAB40 A antibody was raised against the middle region of RAB40

Purification: Affinity purified

Immunogen: RAB40 A antibody was raised using the middle region of RAB40 corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB40A Blocking Peptide, (ABIN5615713), is also available for use as a blocking control in assays to test for specificity of this RAB40A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB40A

Target: RAB40A (RAB40A, Member RAS Oncogene Family (RAB40A))

Alternative Name: RAB40A

Background: RAB40A belongs to the small GTPase superfamily, Rab family. It contains 1 SOCS box domain. RAB40A may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Molecular Weight: 31 kDa (MW of target protein)