RAB40B antibody (Middle Region)

Catalog No. ABIN634429

Product Details anti-RAB40B Antibody

Target: RAB40B (RAB40B, Member RAS Oncogene Family (RAB40B))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB40B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAB40 B antibody was raised against the middle region of RAB40

Purification: Affinity purified

Immunogen: RAB40 B antibody was raised using the middle region of RAB40 corresponding to a region with amino acids YAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB40B Blocking Peptide, catalog no. 33R-10045, is also available for use as a blocking control in assays to test for specificity of this RAB40B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB40B

Target: RAB40B (RAB40B, Member RAS Oncogene Family (RAB40B))

Alternative Name: RAB40B (RAB40B Products)

Synonyms: rab40 antibody, rar antibody, sec4l antibody, xrab40 antibody, zgc:92926 antibody, MGC145203 antibody, RAR antibody, SEC4L antibody, RAB40B antibody, RAB40B, member RAS oncogene family L homeolog antibody, RAB40B, member RAS oncogene family antibody, Rab40B, member RAS oncogene family antibody, Rab40b, member RAS oncogene family antibody, rab40b.L antibody, rab40b antibody, RAB40B antibody, Rab40b antibody

Background: RAB40B has similarity to a yeast protein which suggests a role of the gene product in regulating secretory vesicles.

Molecular Weight: 31 kDa (MW of target protein)