Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

RAB11B, Member RAS Oncogene Family (RAB11B) antibody

Antigen

RAB11B, Member RAS Oncogene Family (RAB11B)

Synonyms H-YPT3, MGC133246, rab11b, MGC52793, MGC85466, zgc:55760, wu:fb07g11
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634441
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name RAB11B
Immunogen RAB11B antibody was raised using the C terminal of RAB11B corresponding to a region with amino acids IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV
Description RAB11B possesses GTPase activity.
Molecular Weight 24 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB11B antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternatives

Alternatives for antigen "RAB11B, Member RAS Oncogene Family (RAB11B)", type "Antibodies"
Hosts Mouse (4), Rabbit (2), Rat (1)
Reactivities Human (5), Mouse (Murine) (3), Rat (Rattus) (1)
Applications Western Blotting (WB) (6), ELISA (2), Immunofluorescence (IF) (2), ELISA (Detection) (1), Enzyme Immunoassay (EIA) (1)