TBL3 antibody

Catalog No. ABIN634442

Product Details anti-TBL3 Antibody

Target: TBL3 (Transducin (Beta)-Like 3 (TBL3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBL3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TBL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBL3 Blocking Peptide, catalog no. 33R-5646, is also available for use as a blocking control in assays to test for specificity of this TBL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBL3

Target: TBL3 (Transducin (Beta)-Like 3 (TBL3))

Alternative Name: TBL3 (TBL3 Products)

Synonyms: MGC69179 antibody, zgc:101778 antibody, AmCG7589 antibody, GB11903 antibody, SAZD antibody, UTP13 antibody, 9430070M15Rik antibody, transducin (beta)-like 3 L homeolog antibody, transducin beta like 3 antibody, transducin (beta)-like 3 antibody, transducin beta-like protein 3 antibody, tbl3.L antibody, TBL3 antibody, tbl3 antibody, LOC724596 antibody, Tbl3 antibody

Background: The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function.

Molecular Weight: 89 kDa (MW of target protein)