RCAN3 antibody (Middle Region)
-
- Target See all RCAN3 Antibodies
- RCAN3 (RCAN Family Member 3 (RCAN3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RCAN3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RCAN3 antibody was raised against the middle region of RCAN3
- Purification
- Affinity purified
- Immunogen
- RCAN3 antibody was raised using the middle region of RCAN3 corresponding to a region with amino acids PGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTRRPDPPTA
- Top Product
- Discover our top product RCAN3 Primary Antibody
-
anti-RCAN Family Member 3 (RCAN3) antibody
RCAN3 Reactivity: Human, Mouse ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-RCAN Family Member 3 (RCAN3) (AA 19-51), (N-Term) antibodyRCAN3 Reactivity: Human, Mouse WB Host: Rabbit Polyclonal RB2314 unconjugated
anti-RCAN Family Member 3 (RCAN3) (C-Term) antibodyRCAN3 Reactivity: Human, Cow, Dog, Guinea Pig, Horse, Rabbit, Monkey, Pig WB Host: Rabbit Polyclonal unconjugated
anti-RCAN Family Member 3 (RCAN3) (N-Term) antibodyRCAN3 Reactivity: Human, Mouse WB, ELISA Host: Rabbit Polyclonal unconjugated
anti-RCAN Family Member 3 (RCAN3) (Middle Region) antibodyRCAN3 Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish (Danio rerio) WB Host: Rabbit Polyclonal unconjugated
anti-RCAN Family Member 3 (RCAN3) (AA 194-222), (C-Term) antibodyRCAN3 Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RCAN3 Blocking Peptide, catalog no. 33R-7100, is also available for use as a blocking control in assays to test for specificity of this RCAN3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCAN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RCAN3 (RCAN Family Member 3 (RCAN3))
- Alternative Name
- RCAN3 (RCAN3 Products)
- Synonyms
- DSCR1L2 antibody, rcn3 antibody, hrcn3 antibody, mcip3 antibody, dscr1l2 antibody, MGC145788 antibody, MCIP3 antibody, RCN3 antibody, hRCN3 antibody, Dscr1l2 antibody, AU041093 antibody, Csp3 antibody, wu:fc68f05 antibody, zgc:113155 antibody, zgc:91820 antibody, RCAN family member 3 antibody, calcipressin-3 antibody, regulator of calcineurin 3 antibody, RCAN3 antibody, Tsp_08182 antibody, rcan3 antibody, Rcan3 antibody
- Background
- RCAN3 inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. It could play a role during central nervous system development.
- Molecular Weight
- 27 kDa (MW of target protein)
-
