LGALS1/Galectin 1 antibody

Catalog No. ABIN634507

This Rabbit Polyclonal antibody specifically detects LGALS1/Galectin 1 in WB. It exhibits reactivity toward Human.

Quick Overview for LGALS1/Galectin 1 antibody (ABIN634507)

Target: LGALS1/Galectin 1 (LGALS1) (Lectin, Galactoside-Binding, Soluble, 1 (LGALS1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LGALS1/Galectin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LGALS1/Galectin 1 Antibody

Purification: Affinity purified

Immunogen: LGALS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LGALS1 Blocking Peptide, (ABIN938062), is also available for use as a blocking control in assays to test for specificity of this LGALS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LGALS1/Galectin 1

Target: LGALS1/Galectin 1 (LGALS1) (Lectin, Galactoside-Binding, Soluble, 1 (LGALS1))

Alternative Name: LGALS1

Background: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation.

Molecular Weight: 15 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis