CXCR2 antibody (N-Term)

Catalog No. ABIN634514

The Rabbit Polyclonal anti-CXCR2 antibody is suitable to detect CXCR2 in samples from Human. It has been validated for WB.

Quick Overview for CXCR2 antibody (N-Term) (ABIN634514)

Target: CXCR2 (Chemokine (C-X-C Motif) Receptor 2 (CXCR2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CXCR2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CXCR2 Antibody

Binding Specificity: N-Term

Specificity: IL8 RB antibody was raised against the N terminal of IL8 B

Purification: Affinity purified

Immunogen: IL8 RB antibody was raised using the N terminal of IL8 B corresponding to a region with amino acids MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL8RB Blocking Peptide, (ABIN5614178), is also available for use as a blocking control in assays to test for specificity of this IL8RB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL0 B antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CXCR2

Target: CXCR2 (Chemokine (C-X-C Motif) Receptor 2 (CXCR2))

Alternative Name: IL8RB

Background: IL8RB is the receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. IL8RB binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: cAMP Metabolic Process