TAP1 antibody

Catalog No. ABIN634533

The Rabbit Polyclonal anti-TAP1 antibody (ABIN634533) specifically detects TAP1 in WB. The antibody is reactive with Human and Mouse samples.

Quick Overview for TAP1 antibody (ABIN634533)

Target: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TAP1 Antibody

Purification: Affinity purified

Immunogen: TAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TAP1 Blocking Peptide, (ABIN5616504), is also available for use as a blocking control in assays to test for specificity of this TAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TAP1

Target: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Alternative Name: TAP1

Background: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).

Molecular Weight: 87 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Human Leukocyte Antigen (HLA) in Adaptive Immune Response