ASB5 antibody (C-Term)

Catalog No. ABIN634568

Product Details anti-ASB5 Antibody

Target: ASB5 (Ankyrin Repeat and SOCS Box Containing 5 (ASB5))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASB5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ASB5 antibody was raised against the C terminal of ASB5

Purification: Affinity purified

Immunogen: ASB5 antibody was raised using the C terminal of ASB5 corresponding to a region with amino acids LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASB5 Blocking Peptide, catalog no. 33R-5157, is also available for use as a blocking control in assays to test for specificity of this ASB5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASB5

Target: ASB5 (Ankyrin Repeat and SOCS Box Containing 5 (ASB5))

Alternative Name: ASB5 (ASB5 Products)

Synonyms: ASB-5 antibody, 1110018D09Rik antibody, ankyrin repeat and SOCS box containing 5 antibody, ankyrin repeat and SOCs box-containing 5 antibody, ankyrin repeat and SOCS box-containing 5 antibody, ASB5 antibody, Asb5 antibody

Background: They contain ankyrin repeat sequence and SOCS box domain. The SOCSbox serves to couple suppressor of cytokine signalling (SOCS)proteins and their binding partners with the elongin B and Ccomplex, possibly targeting them for degradation.

Molecular Weight: 36 kDa (MW of target protein)