TAPBP antibody

Catalog No. ABIN634573

This Rabbit Polyclonal antibody specifically detects TAPBP in WB. It exhibits reactivity toward Human.

Quick Overview for TAPBP antibody (ABIN634573)

Target: TAPBP (TAP Binding Protein (Tapasin) (TAPBP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TAPBP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TAPBP Antibody

Purification: Affinity purified

Immunogen: TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TAPBP Blocking Peptide, (ABIN938747), is also available for use as a blocking control in assays to test for specificity of this TAPBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TAPBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TAPBP

Target: TAPBP (TAP Binding Protein (Tapasin) (TAPBP))

Alternative Name: TAPBP

Background: TAPBP is a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum.

Molecular Weight: 30 kDa (MW of target protein)