PDCD7 antibody (Middle Region)
-
- Target See all PDCD7 Antibodies
- PDCD7 (Programmed Cell Death 7 (PDCD7))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDCD7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PDCD7 antibody was raised against the middle region of PDCD7
- Purification
- Affinity purified
- Immunogen
- PDCD7 antibody was raised using the middle region of PDCD7 corresponding to a region with amino acids YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT
- Top Product
- Discover our top product PDCD7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PDCD7 Blocking Peptide, catalog no. 33R-10177, is also available for use as a blocking control in assays to test for specificity of this PDCD7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDCD7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDCD7 (Programmed Cell Death 7 (PDCD7))
- Alternative Name
- PDCD7 (PDCD7 Products)
- Synonyms
- C80112 antibody, ES18 antibody, HES18 antibody, programmed cell death 7 antibody, Pdcd7 antibody, PDCD7 antibody
- Background
- PDCD7 is a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramide-mediated signalling. These observations suggest that this gene product is involved in specific apoptotic processes in T-cells.
- Molecular Weight
- 55 kDa (MW of target protein)
-