ATG5 antibody

Catalog No. ABIN634588

This Rabbit Polyclonal antibody specifically detects ATG5 in WB and IHC. It exhibits reactivity toward Human and Mouse.

Quick Overview for ATG5 antibody (ABIN634588)

Target: ATG5 (ATG5 Autophagy Related 5 (ATG5))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATG5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-ATG5 Antibody

Purification: Affinity purified

Immunogen: ATG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATG5 Blocking Peptide, (ABIN937485), is also available for use as a blocking control in assays to test for specificity of this ATG5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATG5

Target: ATG5 (ATG5 Autophagy Related 5 (ATG5))

Alternative Name: ATG5

Background: ATG5 is required for autophagy. It conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. ATG5 may play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Production of Molecular Mediator of Immune Response, Autophagy