MAPT antibody (Middle Region)

Catalog No. ABIN634593

The Rabbit Polyclonal anti-MAPT antibody (ABIN634593) specifically detects MAPT in WB. The antibody is reactive with Human samples.

Quick Overview for MAPT antibody (Middle Region) (ABIN634593)

Target: MAPT (Microtubule-Associated Protein tau (MAPT))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAPT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAPT Antibody

Binding Specificity: Middle Region

Specificity: MAPT antibody was raised against the middle region of MAPT

Purification: Affinity purified

Immunogen: MAPT antibody was raised using the middle region of MAPT corresponding to a region with amino acids NAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLAD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAPT Blocking Peptide, (ABIN5614670), is also available for use as a blocking control in assays to test for specificity of this MAPT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAPT

Target: MAPT (Microtubule-Associated Protein tau (MAPT))

Alternative Name: MAPT

Background: MAPT is differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. The mutations in the gene have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: MAPK Signaling, Microtubule Dynamics, M Phase, Regulation of Cell Size