SSX2IP antibody (Middle Region)

Catalog No. ABIN634612

Product Details anti-SSX2IP Antibody

Target: SSX2IP (Synovial Sarcoma, X Breakpoint 2 Interacting Protein (SSX2IP))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SSX2IP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SSX2 IP antibody was raised against the middle region of SSX2 P

Purification: Affinity purified

Immunogen: SSX2 IP antibody was raised using the middle region of SSX2 P corresponding to a region with amino acids KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SSX2IP Blocking Peptide, catalog no. 33R-4706, is also available for use as a blocking control in assays to test for specificity of this SSX2IP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSX0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SSX2IP

Target: SSX2IP (Synovial Sarcoma, X Breakpoint 2 Interacting Protein (SSX2IP))

Alternative Name: SSX2IP (SSX2IP Products)

Synonyms: zgc:73314 antibody, MGC83757 antibody, ADIP antibody, LCG antibody, AU014939 antibody, AU042321 antibody, Adip antibody, synovial sarcoma, X breakpoint 2 interacting protein a antibody, synovial sarcoma, X breakpoint 2 interacting protein S homeolog antibody, SSX family member 2 interacting protein antibody, synovial sarcoma, X 2 interacting protein antibody, ssx2ipa antibody, ssx2ip.S antibody, SSX2IP antibody, Ssx2ip antibody

Background: SSX2IP belongs to an adhesion system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). It may connect the nectin-afadin and E-cadherin-catenin system through alpha-actinin and may be involved in organization of the actin cytoskeleton at AJs through afadin and alpha-actinin.

Molecular Weight: 68 kDa (MW of target protein)