ADAMDEC1 antibody (Middle Region)
-
- Target See all ADAMDEC1 Antibodies
- ADAMDEC1 (ADAM-Like, Decysin 1 (ADAMDEC1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADAMDEC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ADAMDEC1 antibody was raised against the middle region of ADAMDEC1
- Purification
- Affinity purified
- Immunogen
- ADAMDEC1 antibody was raised using the middle region of ADAMDEC1 corresponding to a region with amino acids GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL
- Top Product
- Discover our top product ADAMDEC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADAMDEC1 Blocking Peptide, catalog no. 33R-3436, is also available for use as a blocking control in assays to test for specificity of this ADAMDEC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAMDEC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADAMDEC1 (ADAM-Like, Decysin 1 (ADAMDEC1))
- Alternative Name
- ADAMDEC1 (ADAMDEC1 Products)
- Synonyms
- ADAMDEC1 antibody, 2210414L24Rik antibody, AI574231 antibody, Dcsn antibody, M12.219 antibody, ADAM-like, decysin 1 antibody, ADAM like decysin 1 antibody, Adamdec1 antibody, ADAMDEC1 antibody
- Background
- This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation.
- Molecular Weight
- 53 kDa (MW of target protein)
-