Add to Basket
Order hotline:
![]() |
+1 404 474 4654 |
![]() |
+1 888 205 9894 (TF) |
Fibronectin 1 (FN1) antibody
| Antigen | Fibronectin 1 (FN1) |
| Synonyms |
FN, CIG, FNZ, MSF, ED-B, FINC, GFND, LETS, GFND2, DKFZp686H0342, DKFZp686I1370, DKFZp686F10164, DKFZp686O13149, Fn, Fn-1, MGC117493, E330027I09, fn-1, FIBNEC, FN1, cig, msf, finc, lets, MGC97508, fibr ...
show more
|
| Clonality | Polyclonal |
| Host |
Alternatives Rabbit |
| Application |
Alternatives Western Blotting (WB)
|
| Catalog no. | ABIN634655 |
| Quantity | 50 ug (1 mg/ml) (Variants) |
| Price | 478.33 $ Plus shipping costs $35.00 |
| Shipping to |
|
| Availability | Ships within 5 to 7 Business Days |
Additional Information
| Alternative name | Fibronectin 1 |
| Immunogen | Fibronectin 1 antibody was raised using the N terminal of FN1 corresponding to a region with amino acids GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI |
| Description | FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis and wound healing. |
| Molecular Weight | 71 kDa (MW of target protein) |
| Synonyms | FN, CIG, FNZ, MSF, ED-B, FINC, GFND, LETS, GFND2, DKFZp686H0342, DKFZp686I1370, DKFZp686F10164, DKFZp686O13149, Fn, Fn-1, MGC117493, E330027I09, fn-1, FIBNEC, FN1, cig, msf, finc, lets, MGC97508, fibronectin, fn2, fb80d10, wu:fb80d10 |
Application Details
| Concentration | 1 mg/ml |
| Purification | Affinity purified |
| Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FN1 antibody in PBS |
| Storage | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles. |
Alternatives
Alternatives for antigen "Fibronectin 1 (FN1)", type "Antibodies"
| Hosts | Rabbit (69), Mouse (60), Sheep (8), Goat (2), Chicken (1) |
| Reactivities | Human (97), Mouse (Murine) (22), Rat (Rattus) (22), Cow (Bovine) (9), Chicken (7), Pig (Porcine) (5), Rabbit (5), Bird (Avian) (3), Dog (Canine) (2), Guinea Pig (2), Cat (Feline) (1), Horse (Equine) (1) |
| Applications | Western Blotting (WB) (57), Enzyme Immunoassay (EIA) (52), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (43), ELISA (41), Radioimmunoassay (RIA) (32), Immunohistochemistry (Frozen Sections) (IHC (fro)) (24), Immunofluorescence (IF) (23), Immunohistochemistry (IHC) (20), Immunoprecipitation (IP) (16), Functional Studies (Func) (3), To be determined by user (TBD) (3), Dot Blot (Dot) (2), ELISA (Detection) (2), Immunodiffusion (ID) (2), Immunoelectrophoresis (IEP) (2), Flow Cytometry (FACS) (1), Immunoassay (IA) (1), Nephelometry (Neph) (1), Radial Immunodiffusion (RID) (1) |
| Conjugates | Biotin (11), FITC (3), HRP (2), Alkaline Phosphatase (AP) (1) |




Alternatives