PCDHA12 antibody (N-Term)

Catalog No. ABIN634732

Product Details anti-PCDHA12 Antibody

Target: PCDHA12 (Protocadherin alpha 12 (PCDHA12))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCDHA12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCDHA12 antibody was raised against the N terminal of PCDHA12

Purification: Affinity purified

Immunogen: PCDHA12 antibody was raised using the N terminal of PCDHA12 corresponding to a region with amino acids EVIVDRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDHA12 Blocking Peptide, catalog no. 33R-2791, is also available for use as a blocking control in assays to test for specificity of this PCDHA12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCDHA12

Target: PCDHA12 (Protocadherin alpha 12 (PCDHA12))

Alternative Name: PCDHA12 (PCDHA12 Products)

Synonyms: PCDH-ALPHA12 antibody, Pcdha11 antibody, rCNRv12 antibody, Cnr5 antibody, Crnr5 antibody, Pcdha13 antibody, CNRv12 antibody, PCDHA12 antibody, protocadherin alpha 12 antibody, protocadherin alpha-12 antibody, PCDHA12 antibody, Pcdha12 antibody, LOC102147933 antibody

Background: PCDHA12 is a potential calcium-dependent cell-adhesion protein. PCDHA12 may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molecular Weight: 99 kDa (MW of target protein)