Claudin 15 antibody (Middle Region)

Catalog No. ABIN634748

Product Details anti-Claudin 15 Antibody

Target: Claudin 15 (CLDN15)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Claudin 15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Claudin 15 antibody was raised against the middle region of CLDN15

Purification: Affinity purified

Immunogen: Claudin 15 antibody was raised using the middle region of CLDN15 corresponding to a region with amino acids LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 15 Blocking Peptide, catalog no. 33R-5429, is also available for use as a blocking control in assays to test for specificity of this Claudin 15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Claudin 15

Target: Claudin 15 (CLDN15)

Alternative Name: Claudin 15 (CLDN15 Products)

Synonyms: CLDN15 antibody, cldn15 antibody, cldn15l antibody, zgc:63943 antibody, zgc:136755 antibody, 2210009B08Rik antibody, BB107105 antibody, claudin 15 antibody, claudin 15a antibody, claudin 15b antibody, Cldn15 antibody, CLDN15 antibody, cldn15a antibody, cldn15b antibody

Background: CLDN15 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C