Amyloid beta (A4) Precursor Protein (APP) antibody

Antigen: Amyloid beta (A4) Precursor Protein (APP)

Synonyms: APP, APP-like, APPL, Abeta, BcDNA:GH04413, EG:65F1.5, DmelCG7727, CG7727, AAA, AD1, PN2, ABPP, APPI, CVAP, ABETA, CTFgamma, aaa, ad1, pn2, abpp, appi, cvap, abeta, MGC88882, ctfgamma

Clonality: Polyclonal

Host: Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN634769

Additional Information

Alternative name: APP

Immunogen: APP antibody was raised using the middle region of APP corresponding to a region with amino acids EAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAAN

Description: APP is a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.

Molecular Weight: 77 kDa (MW of target protein)

Application Details

Concentration: 1 mg/ml

Purification: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APP antibody in PBS

Storage: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Research Area: Signaling