CNNM4 antibody (Middle Region)
-
- Target See all CNNM4 Antibodies
- CNNM4 (Cyclin M4 (CNNM4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CNNM4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Cyclin M4 antibody was raised against the middle region of CNNM4
- Purification
- Affinity purified
- Immunogen
- Cyclin M4 antibody was raised using the middle region of CNNM4 corresponding to a region with amino acids LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA
- Top Product
- Discover our top product CNNM4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Cyclin M4 Blocking Peptide, catalog no. 33R-5118, is also available for use as a blocking control in assays to test for specificity of this Cyclin M4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNNM4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CNNM4 (Cyclin M4 (CNNM4))
- Alternative Name
- Cyclin M4 (CNNM4 Products)
- Synonyms
- DKFZp468E0110 antibody, ACDP4 antibody, 5430430O18Rik antibody, Acdp4 antibody, cyclin and CBS domain divalent metal cation transport mediator 4 antibody, cyclin M4 antibody, CNNM4 antibody, CpipJ_CPIJ006743 antibody, cnnm4 antibody, Cnnm4 antibody
- Background
- CNNM4 belongs to the ACDP family.It is a metal transporter. The interaction with the metal ion chaperone COX11 suggests that CNNM4 may play a role in sensory neuron functions.
- Molecular Weight
- 86 kDa (MW of target protein)
-