ENTPD8 antibody (N-Term)

Catalog No. ABIN634955

Product Details anti-ENTPD8 Antibody

Target: ENTPD8 (Ectonucleoside Triphosphate diphosphohydrolase 8 (ENTPD8))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ENTPD8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ENTPD8 antibody was raised against the N terminal of ENTPD8

Purification: Affinity purified

Immunogen: ENTPD8 antibody was raised using the N terminal of ENTPD8 corresponding to a region with amino acids IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ENTPD8 Blocking Peptide, catalog no. 33R-4087, is also available for use as a blocking control in assays to test for specificity of this ENTPD8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENTPD8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ENTPD8

Target: ENTPD8 (Ectonucleoside Triphosphate diphosphohydrolase 8 (ENTPD8))

Alternative Name: ENTPD8 (ENTPD8 Products)

Synonyms: GLSR2492 antibody, NTPDase-8 antibody, UNQ2492 antibody, ENTPD1 antibody, zC10E8.4 antibody, zgc:92065 antibody, si:ch211-10e8.4 antibody, ectonucleoside triphosphate diphosphohydrolase 8 antibody, ectonucleoside triphosphate diphosphohydrolase 8 L homeolog antibody, ENTPD8 antibody, Entpd8 antibody, entpd8 antibody, entpd8.L antibody, Tsp_07798 antibody

Background: ENTPD8 is the canalicular ectonucleoside NTPDase responsible for the main hepatic NTPDase activity. Ectonucleoside NTPDases catalyze the hydrolyzis of gamma- and beta-phosphate residues of nucleotides, playing a central role in concentration of extracellular nucleotides. It has activity toward ATP, ADP, UTP and UDP, but not toward AMP.

Molecular Weight: 54 kDa (MW of target protein)