AFG3L2 antibody

Catalog No. ABIN635053

This Rabbit Polyclonal antibody specifically detects AFG3L2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for AFG3L2 antibody (ABIN635053)

Target: AFG3L2 (AFG3-Like Protein 2 (AFG3L2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AFG3L2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AFG3L2 Antibody

Purification: Affinity purified

Immunogen: AFG3 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AFG3L2 Blocking Peptide, (ABIN5611968), is also available for use as a blocking control in assays to test for specificity of this AFG3L2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AFG0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AFG3L2

Target: AFG3L2 (AFG3-Like Protein 2 (AFG3L2))

Alternative Name: AFG3L2

Background: AFG3L2 is a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. AFG3L2 gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.

Molecular Weight: 88 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development