DIRC2 antibody (Middle Region)

Catalog No. ABIN635117

Product Details anti-DIRC2 Antibody

Target: DIRC2 (Disrupted in Renal Carcinoma 2 (DIRC2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DIRC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DIRC2 antibody was raised against the middle region of DIRC2

Purification: Affinity purified

Immunogen: DIRC2 antibody was raised using the middle region of DIRC2 corresponding to a region with amino acids AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DIRC2 Blocking Peptide, catalog no. 33R-1018, is also available for use as a blocking control in assays to test for specificity of this DIRC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIRC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DIRC2

Target: DIRC2 (Disrupted in Renal Carcinoma 2 (DIRC2))

Alternative Name: DIRC2 (DIRC2 Products)

Synonyms: MGC80843 antibody, zgc:92095 antibody, rcc4 antibody, MGC69320 antibody, RCC4 antibody, disrupted in renal carcinoma 2 antibody, disrupted in renal carcinoma 2 L homeolog antibody, disrupted in renal carcinoma 2 (human) antibody, DIRC2 antibody, dirc2.L antibody, dirc2 antibody, Dirc2 antibody

Background: DIRC2 is a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of DIRC2 by translocation has been associated with haplo-insufficiency and renal cell carcinomas. Alternatively spliced transcript variants have been described, but their biological validity has not yet been determined.

Molecular Weight: 52 kDa (MW of target protein)