SLC12A3 antibody

Catalog No. ABIN635178

The Rabbit Polyclonal anti-SLC12A3 antibody (ABIN635178) specifically detects SLC12A3 in WB. The antibody is reactive with Human samples.

Quick Overview for SLC12A3 antibody (ABIN635178)

Target: SLC12A3 (Solute Carrier Family 12 (Sodium/Chloride Transporters), Member 3 (SLC12A3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC12A3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC12A3 Antibody

Purification: Affinity purified

Immunogen: SLC12 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALIVITLPIGRKGKCPSSLYMAWLETLSQDLRPPVILIRGNQENVLTFYC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC12A3 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SLC12A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC12A3

Target: SLC12A3 (Solute Carrier Family 12 (Sodium/Chloride Transporters), Member 3 (SLC12A3))

Alternative Name: SLC12A3

Background: This gene encodes a renal thiazide-sensitive sodium-chloride cotransporter that is important for electrolyte homeostasis. This cotransporter mediates sodium and chloride reabsorption in the distal convoluted tubule.

Molecular Weight: 114 kDa (MW of target protein)