LPPR5 antibody (N-Term)

Catalog No. ABIN635195

Product Details anti-LPPR5 Antibody

Target: LPPR5 (Lipid Phosphate Phosphatase-Related Protein Type 5 (LPPR5))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LPPR5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PAP2 D antibody was raised against the N terminal of PAP2

Purification: Affinity purified

Immunogen: PAP2 D antibody was raised using the N terminal of PAP2 corresponding to a region with amino acids FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAP2D Blocking Peptide, catalog no. 33R-3109, is also available for use as a blocking control in assays to test for specificity of this PAP2D antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LPPR5

Target: LPPR5 (Lipid Phosphate Phosphatase-Related Protein Type 5 (LPPR5))

Alternative Name: PAP2D (LPPR5 Products)

Synonyms: PAP2 antibody, PAP2D antibody, PRG5 antibody, Lppr5 antibody, PRG-5 antibody, Pap2d antibody, RGD1309567 antibody, LPPR5 antibody, lppr5b antibody, zgc:165526 antibody, phospholipid phosphatase related 5 antibody, phospholipid phosphatase related 5 L homeolog antibody, phospholipid phosphatase related 5b antibody, PLPPR5 antibody, Plppr5 antibody, plppr5.L antibody, plppr5b antibody

Background: PAP2D is a type 2 member of the phosphatidic acid phosphatase (PAP) family. All type 2 members of this protein family contain 6 transmembrane regions, and a consensus N-glycosylation site. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Molecular Weight: 35 kDa (MW of target protein)