RNF217 antibody (Middle Region)

Catalog No. ABIN635258

Product Details anti-RNF217 Antibody

Target: RNF217 (Ring Finger Protein 217 (RNF217))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF217 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF217 antibody was raised against the middle region of RNF217

Purification: Affinity purified

Immunogen: RNF217 antibody was raised using the middle region of RNF217 corresponding to a region with amino acids GLALGAIAVVIVEEIKTYWNLISGRTRNQTQHLAPQPVLLSDMLYCLKQV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF217 Blocking Peptide, catalog no. 33R-3383, is also available for use as a blocking control in assays to test for specificity of this RNF217 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF217 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF217

Target: RNF217 (Ring Finger Protein 217 (RNF217))

Alternative Name: RNF217 (RNF217 Products)

Synonyms: Ibrdc1 antibody, RNF217 antibody, IBRDC1 antibody, C6orf172 antibody, dJ84N20.1 antibody, AU016819 antibody, ring finger protein 217 antibody, ring finger protein 217 L homeolog antibody, Rnf217 antibody, RNF217 antibody, rnf217.L antibody

Background: RNF217 is an E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Molecular Weight: 32 kDa (MW of target protein)