SECTM1 antibody (Middle Region)

Catalog No. ABIN635331

The Rabbit Polyclonal anti-SECTM1 antibody (ABIN635331) specifically detects SECTM1 in WB. The antibody is reactive with Human samples.

Quick Overview for SECTM1 antibody (Middle Region) (ABIN635331)

Target: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SECTM1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SECTM1 Antibody

Binding Specificity: Middle Region

Specificity: SECTM1 antibody was raised against the middle region of SECTM1

Purification: Affinity purified

Immunogen: SECTM1 antibody was raised using the middle region of SECTM1 corresponding to a region with amino acids ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SECTM1 Blocking Peptide, (ABIN936853), is also available for use as a blocking control in assays to test for specificity of this SECTM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SECTM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SECTM1

Target: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Alternative Name: SECTM1

Background: This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.

Molecular Weight: 27 kDa (MW of target protein)