SECTM1 antibody

Catalog No. ABIN4952492

The Rabbit Polyclonal anti-SECTM1 antibody (ABIN4952492) specifically detects SECTM1 in WB. The antibody is reactive with Mouse samples.

Quick Overview for SECTM1 antibody (ABIN4952492)

Target: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SECTM1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SECTM1 Antibody

Purpose: SECTM1 Antibody

Sequence: KLHGFQAEFK NFNLTVNAAD RQKTEDLPVT KVPDK

Purification: Antigen affinity

Immunogen: Amino acids KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK of mouse SECTM1 were used as the immunogen for the SECTM1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the SECTM1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the SECTM1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for SECTM1

Target: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Alternative Name: SECTM1

Background: SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.

UniProt: Q9JL59