NHE8 antibody

Catalog No. ABIN635374

This Rabbit Polyclonal antibody specifically detects NHE8 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for NHE8 antibody (ABIN635374)

Target: NHE8 (SLC9A8) (Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NHE8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NHE8 Antibody

Purification: Affinity purified

Immunogen: SLC9 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC9A8 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SLC9A8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NHE8

Target: NHE8 (SLC9A8) (Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8))

Alternative Name: SLC9A8

Background: Sodium-hydrogen exchangers (NHEs), such as SLC9A8, are integral transmembrane proteins that exchange extracellular Na+ for intracellular H+. NHEs have multiple functions, including intracellular pH homeostasis, cell volume regulation, and electroneutral NaCl absorption in epithelia.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Proton Transport