NHE8 antibody

Catalog No. ABIN635374

Product Details anti-NHE8 Antibody

Target: NHE8 (SLC9A8) (Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NHE8 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC9 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC9A8 Blocking Peptide, catalog no. 33R-1315, is also available for use as a blocking control in assays to test for specificity of this SLC9A8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NHE8

Target: NHE8 (SLC9A8) (Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8))

Alternative Name: SLC9A8 (SLC9A8 Products)

Synonyms: 1200006P13Rik antibody, 6430709P13Rik antibody, AI182282 antibody, NHE8 antibody, nhe8 antibody, wu:fj61b02 antibody, zgc:103660 antibody, NHE-8 antibody, solute carrier family 9 member A8 antibody, solute carrier family 9 member 8 antibody, solute carrier family 9 (sodium/hydrogen exchanger), member 8 antibody, solute carrier family 9, subfamily A (NHE8, cation proton antiporter 8), member 8 antibody, SLC9A8 antibody, slc9a8 antibody, Slc9a8 antibody

Background: Sodium-hydrogen exchangers (NHEs), such as SLC9A8, are integral transmembrane proteins that exchange extracellular Na+ for intracellular H+. NHEs have multiple functions, including intracellular pH homeostasis, cell volume regulation, and electroneutral NaCl absorption in epithelia.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Proton Transport