SLC12A8 antibody
-
- Target See all SLC12A8 (Slc12a8) Antibodies
- SLC12A8 (Slc12a8) (Solute Carrier Family 12 (Potassium/chloride Transporters), Member 8 (Slc12a8))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC12A8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC12 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIRLQLLLLFLLAVSTLDFVVGSFTHLDPEHGFIGYSPELLQNNTLPDYS
- Top Product
- Discover our top product Slc12a8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC12A8 Blocking Peptide, catalog no. 33R-4006, is also available for use as a blocking control in assays to test for specificity of this SLC12A8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC12A8 (Slc12a8) (Solute Carrier Family 12 (Potassium/chloride Transporters), Member 8 (Slc12a8))
- Alternative Name
- SLC12A8 (Slc12a8 Products)
- Synonyms
- CCC9 antibody, E330020C02Rik antibody, Ccc9 antibody, solute carrier family 12 member 8 antibody, zinc finger protein 148 antibody, solute carrier family 12 (potassium/chloride transporters), member 8 antibody, solute carrier family 12, member 8 antibody, solute carrier family 12, member 8 L homeolog antibody, SLC12A8 antibody, ZNF148 antibody, Slc12a8 antibody, slc12a8.L antibody
- Background
- SLC12A8 is a cation/chloride cotransporter that may play a role in the control of keratinocyte proliferation.
- Molecular Weight
- 78 kDa (MW of target protein)
-