FAM171A1 antibody (Middle Region)

Catalog No. ABIN635396

The Rabbit Polyclonal anti-FAM171A1 antibody is suitable to detect FAM171A1 in samples from Human. It has been validated for WB.

Quick Overview for FAM171A1 antibody (Middle Region) (ABIN635396)

Target: FAM171A1 (C10ORF38) (Chromosome 10 Open Reading Frame 38 (C10ORF38))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM171A1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM171A1 Antibody

Binding Specificity: Middle Region

Specificity: C10 ORF38 antibody was raised against the middle region of C10 rf38

Purification: Affinity purified

Immunogen: C10 ORF38 antibody was raised using the middle region of C10 rf38 corresponding to a region with amino acids ARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C10ORF38 Blocking Peptide, (ABIN936865), is also available for use as a blocking control in assays to test for specificity of this C10ORF38 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM171A1

Target: FAM171A1 (C10ORF38) (Chromosome 10 Open Reading Frame 38 (C10ORF38))

Alternative Name: C10ORF38

Background: C10orf38 is probably involved in oxidoreductase activity.

Molecular Weight: 98 kDa (MW of target protein)