EDEM1 antibody (N-Term)

Catalog No. ABIN635444

Product Details anti-EDEM1 Antibody

Target: EDEM1 (ER Degradation Enhancer, Mannosidase alpha-Like 1 (EDEM1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EDEM1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EDEM1 antibody was raised against the N terminal of EDEM1

Purification: Affinity purified

Immunogen: EDEM1 antibody was raised using the N terminal of EDEM1 corresponding to a region with amino acids MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EDEM1 Blocking Peptide, catalog no. 33R-5674, is also available for use as a blocking control in assays to test for specificity of this EDEM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDEM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EDEM1

Target: EDEM1 (ER Degradation Enhancer, Mannosidase alpha-Like 1 (EDEM1))

Alternative Name: EDEM1 (EDEM1 Products)

Synonyms: zgc:55816 antibody, edem antibody, EDEM1 antibody, EDEM antibody, A130059K23Rik antibody, mKIAA0212 antibody, RGD1563633 antibody, ER degradation enhancer, mannosidase alpha-like 1 antibody, ER degradation enhancing alpha-mannosidase like protein 1 antibody, ER degradation-enhancing alpha-mannosidase-like protein 1 antibody, ER degradation enhancing alpha-mannosidase like protein 1 L homeolog antibody, edem1 antibody, EDEM1 antibody, LOC100637820 antibody, edem1.L antibody, Edem1 antibody

Background: EDEM1 belongs to the glycosyl hydrolase 47 family. It extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, from the calnexin cycle. It is directly involved in endoplasmic reticulum-associated degradation (ERAD) and targets misfolded glycoproteins for degradation in an N-glycan-dependent manner.

Molecular Weight: 74 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling