Sphingomyelin Synthase 1 antibody (Middle Region)

Catalog No. ABIN635582

The Rabbit Polyclonal anti-Sphingomyelin Synthase 1 antibody is suitable to detect Sphingomyelin Synthase 1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for Sphingomyelin Synthase 1 antibody (Middle Region) (ABIN635582)

Target: Sphingomyelin Synthase 1 (SGMS1)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Sphingomyelin Synthase 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Sphingomyelin Synthase 1 Antibody

Binding Specificity: Middle Region

Specificity: SGMS1 antibody was raised against the middle region of SGMS1

Purification: Affinity purified

Immunogen: SGMS1 antibody was raised using the middle region of SGMS1 corresponding to a region with amino acids SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SGMS1 Blocking Peptide, (ABIN5616119), is also available for use as a blocking control in assays to test for specificity of this SGMS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGMS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Sphingomyelin Synthase 1

Target: Sphingomyelin Synthase 1 (SGMS1)

Alternative Name: SGMS1

Background: SGMS1 is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin