VSIG1 antibody (N-Term)

Catalog No. ABIN635590

Product Details anti-VSIG1 Antibody

Target: VSIG1 (V-Set and Immunoglobulin Domain Containing 1 (VSIG1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VSIG1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: VSIG1 antibody was raised against the N terminal of VSIG1

Purification: Affinity purified

Immunogen: VSIG1 antibody was raised using the N terminal of VSIG1 corresponding to a region with amino acids SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VSIG1 Blocking Peptide, catalog no. 33R-8544, is also available for use as a blocking control in assays to test for specificity of this VSIG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VSIG1

Target: VSIG1 (V-Set and Immunoglobulin Domain Containing 1 (VSIG1))

Alternative Name: VSIG1 (VSIG1 Products)

Synonyms: VSIG1 antibody, vsig1 antibody, CHT1 antibody, 1700062D20Rik antibody, GPA34 antibody, dJ889N15.1 antibody, 4930405J24Rik antibody, ctx antibody, ctx-A antibody, gpa34 antibody, V-set and immunoglobulin domain containing 1 antibody, V-set and immunoglobulin domain containing 1 L homeolog antibody, VSIG1 antibody, vsig1 antibody, Vsig1 antibody, vsig1.L antibody

Background: The function of VSIG1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 42 kDa (MW of target protein)