SEMA6A antibody (Middle Region)
-
- Target See all SEMA6A Antibodies
- SEMA6A (Sema Domain, Transmembrane Domain (TM), and Cytoplasmic Domain, (Semaphorin) 6A (SEMA6A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SEMA6A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SEMA6 A antibody was raised against the middle region of SEMA6
- Purification
- Affinity purified
- Immunogen
- SEMA6 A antibody was raised using the middle region of SEMA6 corresponding to a region with amino acids ERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNR
- Top Product
- Discover our top product SEMA6A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SEMA6A Blocking Peptide, catalog no. 33R-2716, is also available for use as a blocking control in assays to test for specificity of this SEMA6A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SEMA6A (Sema Domain, Transmembrane Domain (TM), and Cytoplasmic Domain, (Semaphorin) 6A (SEMA6A))
- Alternative Name
- SEMA6A (SEMA6A Products)
- Synonyms
- fj46c12 antibody, wu:fj46c12 antibody, zgc:66106 antibody, SEMA6A antibody, HT018 antibody, SEMA antibody, SEMA6A1 antibody, SEMAQ antibody, VIA antibody, 9330158E07 antibody, A730020P05Rik antibody, AI851735 antibody, Sema6A-1 antibody, Semaq antibody, VIa antibody, b2b997Clo antibody, sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A antibody, semaphorin 6A antibody, sema6a antibody, SEMA6A antibody, Sema6a antibody
- Background
- SEMA6A can act as repulsive axon guidance cues. SEMA6A may play a role in channeling sympathetic axons into the sympathetic chains and controlling the temporal sequence of sympathetic target innervation.
- Molecular Weight
- 114 kDa (MW of target protein)
-